Lineage for d1ha5a1 (1ha5 A:1003-1107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398572Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2398677Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 2398678Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 2398693Domain d1ha5a1: 1ha5 A:1003-1107 [70927]
    Other proteins in same PDB: d1ha5a2, d1ha5b2, d1ha5c2, d1ha5d2
    complexed with zn

Details for d1ha5a1

PDB Entry: 1ha5 (more details), 2.82 Å

PDB Description: structural features of a zinc-binding site in the superantigen streptococcal pyrogenic exotoxin a (spea1): implications for mhc class ii recognition.
PDB Compounds: (A:) streptococcal pyogenic exotoxin a1

SCOPe Domain Sequences for d1ha5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha5a1 b.40.2.2 (A:1003-1107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnha

SCOPe Domain Coordinates for d1ha5a1:

Click to download the PDB-style file with coordinates for d1ha5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ha5a1: