Lineage for d1h77a_ (1h77 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240121Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 240122Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (4 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 240165Family c.7.1.3: Class III anaerobic ribonucleotide triphosphate reductase NRDD subunit [52005] (1 protein)
  6. 240166Protein Class III anaerobic ribonucleotide triphosphate reductase NRDD subunit [52006] (1 species)
  7. 240167Species Bacteriophage T4 [TaxId:10665] [52007] (5 PDB entries)
  8. 240169Domain d1h77a_: 1h77 A: [70909]
    complexed with dgt, fe2, mn; mutant

Details for d1h77a_

PDB Entry: 1h77 (more details), 2.43 Å

PDB Description: structural basis for allosteric substrate specificity regulation in class iii ribonucleotide reductases: nrdd in complex with dgtp

SCOP Domain Sequences for d1h77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h77a_ c.7.1.3 (A:) Class III anaerobic ribonucleotide triphosphate reductase NRDD subunit {Bacteriophage T4}
dsrvfptqrdlmagivskhiaknmvpsfimkahesgiihvhdidyspalpftncclvdlk
gmlengfklgnaqietpksigvataimaqitaqvashqyggttfanvdkvlspyvkrtya
khiedaekwqiadalnyaqsktekdvydafqayeyevntlfssngqtpfvtitfgtgtdw
termiqkailknrikglgrdgitpifpklvmfveegvnlykddpnydikqlalecaskrm
ypdiisaknnkaitgssvpvspmgcrsflsvwkdstgneildgrnnlgvvtlnlpriald
syigtqfneqkfvelfnermdlcfealmcrisslkgvkatvapilyqegafgvrlkpddd
iielfkngrssvslgyigihelnilvgrdigreiltkmnahlkqwtertgfafslystpa
enlcyrfckldtekygsvkdvtdkgwytnsfhvsveenitpfekisreapyhfiatgghi
syvelpdmknnlkgleavwdyaaqhldyfgvnmpvdkcftcgsthemtptengfvcsicg
etdpkkmntirrtcaylgnpn

SCOP Domain Coordinates for d1h77a_:

Click to download the PDB-style file with coordinates for d1h77a_.
(The format of our PDB-style files is described here.)

Timeline for d1h77a_: