Lineage for d1h6za3 (1h6z A:1-405)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873884Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 873885Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 874105Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein)
  6. 874106Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 874118Species Trypanosoma brucei [TaxId:5691] [75557] (1 PDB entry)
  8. 874119Domain d1h6za3: 1h6z A:1-405 [70908]
    Other proteins in same PDB: d1h6za1, d1h6za2

Details for d1h6za3

PDB Entry: 1h6z (more details), 3 Å

PDB Description: 3.0 a resolution crystal structure of glycosomal pyruvate phosphate dikinase from trypanosoma brucei
PDB Compounds: (A:) pyruvate phosphate dikinase

SCOP Domain Sequences for d1h6za3:

Sequence, based on SEQRES records: (download)

>d1h6za3 d.142.1.5 (A:1-405) Pyruvate phosphate dikinase, N-terminal domain {Trypanosoma brucei [TaxId: 5691]}
vakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqetet
ipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasmpgmmdtvlnlglnkvtv
dawvrraprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltasd
lkelcdgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgta
vnvqamvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhsls
lrwakahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlwl
lqcrngkrtihaavriaidmvneglisreeavlridpyqvdhlmh

Sequence, based on observed residues (ATOM records): (download)

>d1h6za3 d.142.1.5 (A:1-405) Pyruvate phosphate dikinase, N-terminal domain {Trypanosoma brucei [TaxId: 5691]}
vakkwvyyfgggnadgnknmkellggkganlaemvnlgipvppgftitteacktyqetet
ipqevadqvrenvsrvekemgakfgdpanpllfsvrsgaaasdtvlnlglnkvtvdawvr
raprlerfvydsyrrfitmyadivmqvgredfeealsrmkerrgtkfdtdltasdlkelc
dgylelfelktgcsfpqdpvmqlfaaikavfrswgnpratiyrrmnnitgllgtavnvqa
mvfgnindrsatgvafsrspstgenfffgeylvnaqgedvvagirtpqqinhslslrwak
ahgvgeeerrkrypsmeeampenyrllcdvrkrlenhyrdmqdleftvqdgrlwllqcrn
gkrtihaavriaidmvneglisreeavlridpyqvdhlmh

SCOP Domain Coordinates for d1h6za3:

Click to download the PDB-style file with coordinates for d1h6za3.
(The format of our PDB-style files is described here.)

Timeline for d1h6za3: