SCOPe 2.08: Domain d1h6xa1: 1h6x A:3-160

Lineage for d1h6xa1 (1h6x A:3-160)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.7: CBM22 [49811] (1 protein)
   CBM family 22, formerly x6b domain
   automatically mapped to Pfam PF02018

6. Protein Xylan-binding domain [49812] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [49813] (3 PDB entries)

8. Domain d1h6xa1: 1h6x A:3-160 [70903]
   Other proteins in same PDB: d1h6xa2
   complexed with ca

Details for d1h6xa1

PDB Entry: 1h6x, 2.23 Å

PDB Description: the role of conserved amino acids in the cleft of the c-terminal family 22 carbohydrate binding module of clostridium thermocellum xyn10b in ligand binding

PDB Compounds: (A:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1h6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1h6xa1 b.18.1.7 (A:3-160) Xylan-binding domain {Clostridium thermocellum [TaxId: 1515]}
epdangyyyhdtfegsvgqwtaagpaevllsgrtaykgsesllvrnrtaawngaqralnp
rtfvpgntycfsvvasfiegassttfcmklqyvdgsgtqrydtidmktvgpnqwvhlynp
qyripsdatdmyvyvetaddtinfyideaigavagtvi

Timeline for d1h6xa1:

• d1h6xa1 first appeared in SCOP 1.61, called d1h6xa_
  
• d1h6xa1 appears in SCOPe 2.07