Lineage for d1h5da_ (1h5d A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1497233Protein Plant peroxidase [48125] (6 species)
  7. 1497236Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 1497250Domain d1h5da_: 1h5d A: [70884]
    complexed with act, ca, hem

Details for d1h5da_

PDB Entry: 1h5d (more details), 1.6 Å

PDB Description: x-ray induced reduction of horseradish peroxidase c1a compound iii (0-11% dose)
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d1h5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5da_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOPe Domain Coordinates for d1h5da_:

Click to download the PDB-style file with coordinates for d1h5da_.
(The format of our PDB-style files is described here.)

Timeline for d1h5da_: