Lineage for d1h58a_ (1h58 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333359Protein Plant peroxidase [48125] (6 species)
  7. 2333362Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 2333380Domain d1h58a_: 1h58 A: [70879]
    complexed with act, ca, hem

Details for d1h58a_

PDB Entry: 1h58 (more details), 1.7 Å

PDB Description: structure of ferrous horseradish peroxidase c1a
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d1h58a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h58a_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOPe Domain Coordinates for d1h58a_:

Click to download the PDB-style file with coordinates for d1h58a_.
(The format of our PDB-style files is described here.)

Timeline for d1h58a_: