Lineage for d1h4la_ (1h4l A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512255Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 512256Species Human (Homo sapiens) [TaxId:9606] [88858] (1 PDB entry)
  8. 512257Domain d1h4la_: 1h4l A: [70871]
    Other proteins in same PDB: d1h4ld_, d1h4le_

Details for d1h4la_

PDB Entry: 1h4l (more details), 2.65 Å

PDB Description: structure and regulation of the cdk5-p25(nck5a) complex

SCOP Domain Sequences for d1h4la_:

Sequence, based on SEQRES records: (download)

>d1h4la_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens)}
qkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhk
nivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrn
vlhrdlkpqnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklyst
sidmwsagcifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypm
ypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs

Sequence, based on observed residues (ATOM records): (download)

>d1h4la_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens)}
qkyeklekiygtvfkaknretheivalkrvrldgvpssalreicllkelkhknivrlhdv
lhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkp
qnllinrngelkladfglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsag
cifaelanaarplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslv
nvvpklnatgrdllqnllkcnpvqrisaeealqhpyfs

SCOP Domain Coordinates for d1h4la_:

Click to download the PDB-style file with coordinates for d1h4la_.
(The format of our PDB-style files is described here.)

Timeline for d1h4la_: