Lineage for d1h0oa_ (1h0o A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151499Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 151500Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 151635Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 151727Protein Ribonucleotide reductase R2 [47257] (5 species)
  7. 151765Species Mouse (Mus musculus) [TaxId:10090] [47260] (3 PDB entries)
  8. 151766Domain d1h0oa_: 1h0o A: [70845]

Details for d1h0oa_

PDB Entry: 1h0o (more details), 2.2 Å

PDB Description: cobalt substitution of mouse r2 ribonucleotide reductase to model the reactive diferrous state

SCOP Domain Sequences for d1h0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0oa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus)}
npsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpde
rhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidty
ikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasi
fwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqef
ltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfme

SCOP Domain Coordinates for d1h0oa_:

Click to download the PDB-style file with coordinates for d1h0oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h0oa_: