Lineage for d1gzqa2 (1gzq A:3-183)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1197985Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species)
    Class I MHC-related
  7. 1197992Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (3 PDB entries)
  8. 1197993Domain d1gzqa2: 1gzq A:3-183 [70819]
    Other proteins in same PDB: d1gzqa1, d1gzqb_
    complexed with d12, no3, pii, twt

Details for d1gzqa2

PDB Entry: 1gzq (more details), 2.26 Å

PDB Description: cd1b in complex with phophatidylinositol
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d1gzqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzqa2 d.19.1.1 (A:3-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
afqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdke
vaeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggld
flsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlq
r

SCOPe Domain Coordinates for d1gzqa2:

Click to download the PDB-style file with coordinates for d1gzqa2.
(The format of our PDB-style files is described here.)

Timeline for d1gzqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gzqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1gzqb_