SCOPe 2.08: Domain d1gzqa2: 1gzq A:3-183

Lineage for d1gzqa2 (1gzq A:3-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)

8. Domain d1gzqa2: 1gzq A:3-183 [70819]
   Other proteins in same PDB: d1gzqa1, d1gzqa3, d1gzqb2, d1gzqb3
   complexed with d12, no3, pii, twt

Details for d1gzqa2

PDB Entry: 1gzq, 2.26 Å

PDB Description: cd1b in complex with phophatidylinositol

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d1gzqa2:

Sequence; same for both SEQRES and ATOM records:

>d1gzqa2 d.19.1.1 (A:3-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
afqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdke
vaeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggld
flsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlq
r

Timeline for d1gzqa2:

• d1gzqa2 first appeared in SCOP 1.61
  
• d1gzqa2 appears in SCOPe 2.07