SCOPe 2.08: Domain d1gzqa1: 1gzq A:184-279

Lineage for d1gzqa1 (1gzq A:184-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries)

8. Domain d1gzqa1: 1gzq A:184-279 [70818]
   Other proteins in same PDB: d1gzqa2, d1gzqa3, d1gzqb2, d1gzqb3
   complexed with d12, no3, pii, twt

Details for d1gzqa1

PDB Entry: 1gzq, 2.26 Å

PDB Description: cd1b in complex with phophatidylinositol

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d1gzqa1:

Sequence; same for both SEQRES and ATOM records:

>d1gzqa1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywgp

Timeline for d1gzqa1:

• d1gzqa1 first appeared in SCOP 1.61
  
• d1gzqa1 appears in SCOPe 2.07