![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein CD1, beta2-microglobulin and alpha-3 domain [49130] (2 species) |
![]() | Species Human (Homo sapiens), CD1b [TaxId:9606] [74838] (2 PDB entries) |
![]() | Domain d1gzpb1: 1gzp B: [70817] Other proteins in same PDB: d1gzpa2 |
PDB Entry: 1gzp (more details), 2.8 Å
SCOP Domain Sequences for d1gzpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzpb1 b.1.1.2 (B:) CD1, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), CD1b} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1gzpb1: