Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (2 species) |
Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (2 PDB entries) |
Domain d1gzpa2: 1gzp A:4-183 [70816] Other proteins in same PDB: d1gzpa1, d1gzpb1 |
PDB Entry: 1gzp (more details), 2.8 Å
SCOP Domain Sequences for d1gzpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzpa2 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b} fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr
Timeline for d1gzpa2: