Lineage for d1gzpa1 (1gzp A:184-280)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654498Protein CD1, alpha-3 domain [88615] (3 species)
  7. 654505Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (3 PDB entries)
  8. 654507Domain d1gzpa1: 1gzp A:184-280 [70815]
    Other proteins in same PDB: d1gzpa2, d1gzpb_
    complexed with d12, gm2, twt

Details for d1gzpa1

PDB Entry: 1gzp (more details), 2.8 Å

PDB Description: cd1b in complex with gm2 ganglioside
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOP Domain Sequences for d1gzpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzpa1 b.1.1.2 (A:184-280) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlssgpspgpgrlqlvchvsgfypkpvwvmwmrgeqeqqgtqlgdilpnanwtw
ylratldvadgeaaglscrvkhsslegqdiilywgpg

SCOP Domain Coordinates for d1gzpa1:

Click to download the PDB-style file with coordinates for d1gzpa1.
(The format of our PDB-style files is described here.)

Timeline for d1gzpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gzpa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gzpb_