Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries) |
Domain d1gzhc_: 1gzh C: [70810] Other proteins in same PDB: d1gzhb1, d1gzhb2, d1gzhd1, d1gzhd2 complexed with so4, zn |
PDB Entry: 1gzh (more details), 2.6 Å
SCOPe Domain Sequences for d1gzhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzhc_ b.2.5.2 (C:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh svvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrv cacpgrdrrteeenlr
Timeline for d1gzhc_: