SCOP 1.65: Domain d1gz4b2: 1gz4 B:23-279

Lineage for d1gz4b2 (1gz4 B:23-279)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

Family c.58.1.3: Mitochondrial NAD(P)-dependenent malic enzyme [53240] (1 protein)
this domain is decorated with additional structures; includes N-terminal additional subdomains and exta N-terminal strand

Protein Mitochondrial NAD(P)-dependenent malic enzyme [53241] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [53242] (7 PDB entries)
Domain d1gz4b2: 1gz4 B:23-279 [70797]
Other proteins in same PDB: d1gz4a1, d1gz4b1, d1gz4c1, d1gz4d1

Details for d1gz4b2

PDB Entry: 1gz4 (more details), 2.2 Å

PDB Description: molecular mechanism of the regulation of human mitochondrial nad(p)+-dependent malic enzyme by atp and fumarate

SCOP Domain Sequences for d1gz4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz4b2 c.58.1.3 (B:23-279) Mitochondrial NAD(P)-dependenent malic enzyme {Human (Homo sapiens)}
ekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtspleky
iyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrgh
vrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpvc
idvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhna
frflrkyrekyctfndd

SCOP Domain Coordinates for d1gz4b2:

Click to download the PDB-style file with coordinates for d1gz4b2.
(The format of our PDB-style files is described here.)

Timeline for d1gz4b2: