Lineage for d1gz4a1 (1gz4 A:280-573)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175982Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 176073Protein Mitochondrial NAD(P)-dependenent malic enzyme [51898] (3 species)
  7. 176091Species Human (Homo sapiens) [TaxId:9606] [51899] (5 PDB entries)
  8. 176092Domain d1gz4a1: 1gz4 A:280-573 [70794]
    Other proteins in same PDB: d1gz4a2, d1gz4b2, d1gz4c2, d1gz4d2

Details for d1gz4a1

PDB Entry: 1gz4 (more details), 2.2 Å

PDB Description: molecular mechanism of the regulation of human mitochondrial nad(p)+-dependent malic enzyme by atp and fumarate

SCOP Domain Sequences for d1gz4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz4a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependenent malic enzyme {Human (Homo sapiens)}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOP Domain Coordinates for d1gz4a1:

Click to download the PDB-style file with coordinates for d1gz4a1.
(The format of our PDB-style files is described here.)

Timeline for d1gz4a1: