Class a: All alpha proteins [46456] (290 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) automatically mapped to Pfam PF00453 |
Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
Protein Ribosomal protein L20 [74733] (4 species) |
Species Aquifex aeolicus [TaxId:63363] [74734] (1 PDB entry) |
Domain d1gyza_: 1gyz A: [70793] fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1gyz (more details)
SCOPe Domain Sequences for d1gyza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyza_ a.144.2.1 (A:) Ribosomal protein L20 {Aquifex aeolicus [TaxId: 63363]} wiarinaavrayglnystfinglkkagieldrkiladmavrdpqafeqvvnkvkealqvq
Timeline for d1gyza_: