Lineage for d1gyza_ (1gyz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734855Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2734896Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2734897Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2734898Protein Ribosomal protein L20 [74733] (4 species)
  7. 2734899Species Aquifex aeolicus [TaxId:63363] [74734] (1 PDB entry)
  8. 2734900Domain d1gyza_: 1gyz A: [70793]
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1gyza_

PDB Entry: 1gyz (more details)

PDB Description: bacterial ribosomal protein l20 from aquifex aeolicus
PDB Compounds: (A:) 50S ribosomal protein L20

SCOPe Domain Sequences for d1gyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyza_ a.144.2.1 (A:) Ribosomal protein L20 {Aquifex aeolicus [TaxId: 63363]}
wiarinaavrayglnystfinglkkagieldrkiladmavrdpqafeqvvnkvkealqvq

SCOPe Domain Coordinates for d1gyza_:

Click to download the PDB-style file with coordinates for d1gyza_.
(The format of our PDB-style files is described here.)

Timeline for d1gyza_: