SCOPe 2.07: Domain d1gyua1: 1gyu A:704-822

Lineage for d1gyua1 (1gyu A:704-822)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
   consist of a single subdomain
   automatically mapped to Pfam PF02883

6. Protein Gamma1-adaptin domain [74858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries)

8. Domain d1gyua1: 1gyu A:704-822 [70789]
   Other proteins in same PDB: d1gyua2

Details for d1gyua1

PDB Entry: 1gyu, 1.81 Å

PDB Description: gamma-adaptin appendage domain from clathrin adaptor ap1

PDB Compounds: (A:) adapter-related protein complex 1 gamma 1 subunit

SCOPe Domain Sequences for d1gyua1:

Sequence; same for both SEQRES and ATOM records:

>d1gyua1 b.1.10.2 (A:704-822) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
ipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlqll
spsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

Timeline for d1gyua1:

• d1gyua1 first appeared in SCOP 1.61, called d1gyua_
  
• d1gyua1 appears in SCOPe 2.06
  
• d1gyua1 appears in the current release, SCOPe 2.08