Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein RhoE (RND3) [75201] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [75202] (2 PDB entries) |
Domain d1gwnc_: 1gwn C: [70673] complexed with gtp, mo2 |
PDB Entry: 1gwn (more details), 2.1 Å
SCOP Domain Sequences for d1gwnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwnc_ c.37.1.8 (C:) RhoE (RND3) {Mouse (Mus musculus)} kckivvvgdsqcgktallhvfakdcfpenyvptvfenytasfeidtqrielslwdtsgsp yydnvrplsypdsdavlicfdisrpetldsvlkkwkgeiqefcpntkmllvgcksdlrtd vstlvelsnhrqtpvsydqganmakqigaatyiecsalqsensvrdifhvatlacvnk
Timeline for d1gwnc_: