SCOP 1.71: Domain d1gwnc_: 1gwn C:

Lineage for d1gwnc_ (1gwn C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoE (RND3) [75201] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [75202] (2 PDB entries)

8. Domain d1gwnc_: 1gwn C: [70673]
   complexed with gtp, mo2

Details for d1gwnc_

PDB Entry: 1gwn, 2.1 Å

PDB Description: the crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein

SCOP Domain Sequences for d1gwnc_:

Sequence; same for both SEQRES and ATOM records:

>d1gwnc_ c.37.1.8 (C:) RhoE (RND3) {Mouse (Mus musculus)}
kckivvvgdsqcgktallhvfakdcfpenyvptvfenytasfeidtqrielslwdtsgsp
yydnvrplsypdsdavlicfdisrpetldsvlkkwkgeiqefcpntkmllvgcksdlrtd
vstlvelsnhrqtpvsydqganmakqigaatyiecsalqsensvrdifhvatlacvnk

Timeline for d1gwnc_:

• d1gwnc_ first appeared in SCOP 1.61
  
• d1gwnc_ appears in SCOP 1.69
  
• d1gwnc_ appears in SCOP 1.73
  
• d1gwnc_ appears in the current release, SCOPe 2.08