SCOPe 2.06: Domain d1gwna_: 1gwn A:

Lineage for d1gwna_ (1gwn A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein RhoE (RND3) [75201] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [75202] (2 PDB entries)

8. Domain d1gwna_: 1gwn A: [70672]
   complexed with gtp, mg

Details for d1gwna_

PDB Entry: 1gwn, 2.1 Å

PDB Description: the crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein

PDB Compounds: (A:) rho-related GTP-binding protein rhoe

SCOPe Domain Sequences for d1gwna_:

Sequence; same for both SEQRES and ATOM records:

>d1gwna_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}
vkckivvvgdsqcgktallhvfakdcfpenyvptvfenytasfeidtqrielslwdtsgs
pyydnvrplsypdsdavlicfdisrpetldsvlkkwkgeiqefcpntkmllvgcksdlrt
dvstlvelsnhrqtpvsydqganmakqigaatyiecsalqsensvrdifhvatlacvnk

Timeline for d1gwna_:

• d1gwna_ first appeared in SCOP 1.61
  
• d1gwna_ appears in SCOPe 2.05
  
• d1gwna_ appears in SCOPe 2.07
  
• d1gwna_ appears in the current release, SCOPe 2.08