Lineage for d1gwcc1 (1gwc C:87-225)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281847Protein Class tau GST [81354] (2 species)
  7. 281853Species Wheat (Triticum tauschii l.) [74726] (1 PDB entry)
  8. 281856Domain d1gwcc1: 1gwc C:87-225 [70664]
    Other proteins in same PDB: d1gwca2, d1gwcb2, d1gwcc2
    complexed with gtx, so4

Details for d1gwcc1

PDB Entry: 1gwc (more details), 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

SCOP Domain Sequences for d1gwcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwcc1 a.45.1.1 (C:87-225) Class tau GST {Wheat (Triticum tauschii l.)}
llpadpyeraiarfwvayvddklvapwrqwlrgkteeeksegkkqafaavgvlegalrec
skgggffggdgvglvdvalggvlswmkvtealsgdkifdaaktpllaawverfieldaak
aalpdvgrllefakareaa

SCOP Domain Coordinates for d1gwcc1:

Click to download the PDB-style file with coordinates for d1gwcc1.
(The format of our PDB-style files is described here.)

Timeline for d1gwcc1: