Lineage for d1gwca2 (1gwc A:4-86)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315307Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 315308Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 315468Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 315786Protein Class tau GST [81365] (2 species)
  7. 315792Species Wheat (Triticum tauschii l.) [75236] (1 PDB entry)
  8. 315793Domain d1gwca2: 1gwc A:4-86 [70661]
    Other proteins in same PDB: d1gwca1, d1gwcb1, d1gwcc1

Details for d1gwca2

PDB Entry: 1gwc (more details), 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

SCOP Domain Sequences for d1gwca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Wheat (Triticum tauschii l.)}
gddlkllgawpspfvtrvklalalkglsyedveedlykkselllksnpvhkkipvlihng
apvcesmiilqyidevfastgps

SCOP Domain Coordinates for d1gwca2:

Click to download the PDB-style file with coordinates for d1gwca2.
(The format of our PDB-style files is described here.)

Timeline for d1gwca2: