SCOP 1.63: Domain d1gwca2: 1gwc A:4-86

Lineage for d1gwca2 (1gwc A:4-86)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class tau GST [81365] (1 species)

7. Species Wheat (Triticum tauschii l.) [75236] (1 PDB entry)

8. Domain d1gwca2: 1gwc A:4-86 [70661]
   Other proteins in same PDB: d1gwca1, d1gwcb1, d1gwcc1

Details for d1gwca2

PDB Entry: 1gwc, 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

SCOP Domain Sequences for d1gwca2:

Sequence; same for both SEQRES and ATOM records:

>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Wheat (Triticum tauschii l.)}
gddlkllgawpspfvtrvklalalkglsyedveedlykkselllksnpvhkkipvlihng
apvcesmiilqyidevfastgps

Timeline for d1gwca2:

• d1gwca2 first appeared in SCOP 1.61
  
• d1gwca2 appears in SCOP 1.65
  
• d1gwca2 appears in the current release, SCOPe 2.08