Lineage for d1gwca1 (1gwc A:87-224)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999370Protein Class tau GST [81354] (2 species)
  7. 1999371Species Aegilops tauschii, also known as Triticum tauschii [TaxId:37682] [74726] (1 PDB entry)
  8. 1999372Domain d1gwca1: 1gwc A:87-224 [70660]
    Other proteins in same PDB: d1gwca2, d1gwcb2, d1gwcc2
    complexed with gtx, so4

Details for d1gwca1

PDB Entry: 1gwc (more details), 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification
PDB Compounds: (A:) glutathione s-transferase tsi-1

SCOPe Domain Sequences for d1gwca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}
llpadpyeraiarfwvayvddklvapwrqwlrgkteeeksegkkqafaavgvlegalrec
skgggffggdgvglvdvalggvlswmkvtealsgdkifdaaktpllaawverfieldaak
aalpdvgrllefakarea

SCOPe Domain Coordinates for d1gwca1:

Click to download the PDB-style file with coordinates for d1gwca1.
(The format of our PDB-style files is described here.)

Timeline for d1gwca1: