SCOP 1.73: Domain d1gw5s_: 1gw5 S:

Lineage for d1gw5s_ (1gw5 S:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (4 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins)

6. Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [75525] (1 PDB entry)

8. Domain d1gw5s_: 1gw5 S: [70633]
   Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5m1, d1gw5m2
   complexed with ihp

Details for d1gw5s_

PDB Entry: 1gw5, 2.59 Å

PDB Description: ap2 clathrin adaptor core

PDB Compounds: (S:) clathrin coat assembly protein ap17

SCOP Domain Sequences for d1gw5s_:

Sequence; same for both SEQRES and ATOM records:

>d1gw5s_ d.110.4.2 (S:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

Timeline for d1gw5s_:

• d1gw5s_ first appeared in SCOP 1.61
  
• d1gw5s_ appears in SCOP 1.71
  
• d1gw5s_ last appears in SCOP 1.75