Lineage for d1gw5s_ (1gw5 S:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195728Fold d.110: Profilin-like [55769] (6 superfamilies)
  4. 195840Superfamily d.110.6: Clathrin coat assembly domain [75520] (1 family) (S)
  5. 195841Family d.110.6.1: Clathrin coat assembly domain [75521] (2 proteins)
  6. 195845Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)
  7. 195846Species Mouse (Mus musculus) [TaxId:10090] [75525] (1 PDB entry)
  8. 195847Domain d1gw5s_: 1gw5 S: [70633]
    Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5m1, d1gw5m2

Details for d1gw5s_

PDB Entry: 1gw5 (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core

SCOP Domain Sequences for d1gw5s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw5s_ d.110.6.1 (S:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus)}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

SCOP Domain Coordinates for d1gw5s_:

Click to download the PDB-style file with coordinates for d1gw5s_.
(The format of our PDB-style files is described here.)

Timeline for d1gw5s_: