SCOP 1.75: Domain d1gw5m2: 1gw5 M:1-141

Lineage for d1gw5m2 (1gw5 M:1-141)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (4 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins)

6. Protein Mu2 adaptin (clathrin coat assembly protein AP50) [75522] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [75523] (1 PDB entry)

8. Domain d1gw5m2: 1gw5 M:1-141 [70632]
   Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5s_
   complexed with ihp

Details for d1gw5m2

PDB Entry: 1gw5, 2.59 Å

PDB Description: ap2 clathrin adaptor core

PDB Compounds: (M:) clathrin coat assembly protein ap50

SCOP Domain Sequences for d1gw5m2:

Sequence; same for both SEQRES and ATOM records:

>d1gw5m2 d.110.4.2 (M:1-141) Mu2 adaptin (clathrin coat assembly protein AP50) {Rat (Rattus norvegicus) [TaxId: 10116]}
migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
pqnsetgalktfitqqgiksq

Timeline for d1gw5m2:

• d1gw5m2 first appeared in SCOP 1.61
  
• d1gw5m2 appears in SCOP 1.73
  
• d1gw5m2 does not appear in SCOPe 2.01