Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.110: Profilin-like [55769] (7 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.4: SNARE-like [64356] (4 families) beta(2)-alpha-beta(3)-alpha(2) |
Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins) |
Protein Mu2 adaptin (clathrin coat assembly protein AP50) [75522] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [75523] (1 PDB entry) |
Domain d1gw5m2: 1gw5 M:1-141 [70632] Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5m1, d1gw5s_ complexed with ihp |
PDB Entry: 1gw5 (more details), 2.59 Å
SCOP Domain Sequences for d1gw5m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw5m2 d.110.4.2 (M:1-141) Mu2 adaptin (clathrin coat assembly protein AP50) {Rat (Rattus norvegicus)} migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy pqnsetgalktfitqqgiksq
Timeline for d1gw5m2: