Lineage for d1gw5m2 (1gw5 M:1-141)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261219Fold d.110: Profilin-like [55769] (5 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 261330Superfamily d.110.4: SNARE-like [64356] (3 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 261339Family d.110.4.2: Clathrin coat assembly domain [75521] (2 proteins)
  6. 261340Protein Mu2 adaptin (clathrin coat assembly protein AP50) [75522] (1 species)
  7. 261341Species Rat (Rattus norvegicus) [TaxId:10116] [75523] (1 PDB entry)
  8. 261342Domain d1gw5m2: 1gw5 M:1-141 [70632]
    Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5m1, d1gw5s_
    complexed with ihp

Details for d1gw5m2

PDB Entry: 1gw5 (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core

SCOP Domain Sequences for d1gw5m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw5m2 d.110.4.2 (M:1-141) Mu2 adaptin (clathrin coat assembly protein AP50) {Rat (Rattus norvegicus)}
migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
pqnsetgalktfitqqgiksq

SCOP Domain Coordinates for d1gw5m2:

Click to download the PDB-style file with coordinates for d1gw5m2.
(The format of our PDB-style files is described here.)

Timeline for d1gw5m2: