Lineage for d1gw5m1 (1gw5 M:159-435)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659776Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (1 family) (S)
    duplication: one domain of this fold is inserted into another domain of the same fold
  5. 659777Family b.2.7.1: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49448] (1 protein)
  6. 659778Protein Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49449] (2 species)
  7. 659781Species Rat (Rattus norvegicus) [TaxId:10116] [49450] (6 PDB entries)
  8. 659786Domain d1gw5m1: 1gw5 M:159-435 [70631]
    Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5m2, d1gw5s_
    complexed with ihp

Details for d1gw5m1

PDB Entry: 1gw5 (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core
PDB Compounds: (M:) clathrin coat assembly protein ap50

SCOP Domain Sequences for d1gw5m1:

Sequence, based on SEQRES records: (download)

>d1gw5m1 b.2.7.1 (M:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kiviekqgkgtadetsksgkqkiaiddctfhqcvrlskfdsersisfippdgefelmryr
ttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicm
kgkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsg
lkvrylkvfepklnysdhdvikwvryigrsgiyetrc

Sequence, based on observed residues (ATOM records): (download)

>d1gw5m1 b.2.7.1 (M:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Rat (Rattus norvegicus) [TaxId: 10116]}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kivikiaiddctfhqcvrlsrsisfippdgefelmryrttkdiilpfrviplvrevgrtk
levkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrmag
mkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvik
wvryigrsgiyetrc

SCOP Domain Coordinates for d1gw5m1:

Click to download the PDB-style file with coordinates for d1gw5m1.
(The format of our PDB-style files is described here.)

Timeline for d1gw5m1: