Class b: All beta proteins [48724] (165 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (1 family) duplication: one domain of this fold is inserted into another domain of the same fold |
Family b.2.7.1: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49448] (1 protein) |
Protein Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49449] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [49450] (6 PDB entries) |
Domain d1gw5m1: 1gw5 M:159-435 [70631] Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5m2, d1gw5s_ complexed with ihp |
PDB Entry: 1gw5 (more details), 2.59 Å
SCOP Domain Sequences for d1gw5m1:
Sequence, based on SEQRES records: (download)
>d1gw5m1 b.2.7.1 (M:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Rat (Rattus norvegicus) [TaxId: 10116]} igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd kiviekqgkgtadetsksgkqkiaiddctfhqcvrlskfdsersisfippdgefelmryr ttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicm kgkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsg lkvrylkvfepklnysdhdvikwvryigrsgiyetrc
>d1gw5m1 b.2.7.1 (M:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Rat (Rattus norvegicus) [TaxId: 10116]} igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd kivikiaiddctfhqcvrlsrsisfippdgefelmryrttkdiilpfrviplvrevgrtk levkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrmag mkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvik wvryigrsgiyetrc
Timeline for d1gw5m1: