Lineage for d1gw5m1 (1gw5 M:159-435)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223643Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 223915Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (1 family) (S)
    duplication: one domain of this fold is inserted into another domain of the same fold
  5. 223916Family b.2.7.1: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49448] (1 protein)
  6. 223917Protein Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49449] (2 species)
  7. 223920Species Rat (Rattus norvegicus) [TaxId:10116] [49450] (5 PDB entries)
  8. 223924Domain d1gw5m1: 1gw5 M:159-435 [70631]
    Other proteins in same PDB: d1gw5a_, d1gw5b_, d1gw5m2, d1gw5s_
    complexed with ihp

Details for d1gw5m1

PDB Entry: 1gw5 (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core

SCOP Domain Sequences for d1gw5m1:

Sequence, based on SEQRES records: (download)

>d1gw5m1 b.2.7.1 (M:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Rat (Rattus norvegicus)}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kiviekqgkgtadetsksgkqkiaiddctfhqcvrlskfdsersisfippdgefelmryr
ttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicm
kgkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsg
lkvrylkvfepklnysdhdvikwvryigrsgiyetrc

Sequence, based on observed residues (ATOM records): (download)

>d1gw5m1 b.2.7.1 (M:159-435) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Rat (Rattus norvegicus)}
igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
kivikiaiddctfhqcvrlsrsisfippdgefelmryrttkdiilpfrviplvrevgrtk
levkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrmag
mkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvik
wvryigrsgiyetrc

SCOP Domain Coordinates for d1gw5m1:

Click to download the PDB-style file with coordinates for d1gw5m1.
(The format of our PDB-style files is described here.)

Timeline for d1gw5m1: