![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (17 families) ![]() |
![]() | Family a.118.1.10: Clathrin adaptor core protein [74771] (2 proteins) |
![]() | Protein Adaptin beta subunit N-terminal fragment [74774] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74775] (1 PDB entry) |
![]() | Domain d1gw5b_: 1gw5 B: [70630] Other proteins in same PDB: d1gw5a_, d1gw5m1, d1gw5m2, d1gw5s_ complexed with ihp |
PDB Entry: 1gw5 (more details), 2.59 Å
SCOP Domain Sequences for d1gw5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw5b_ a.118.1.10 (B:) Adaptin beta subunit N-terminal fragment {Human (Homo sapiens)} skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt lltaivklflkkpsetqelvqqvlsxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxieptlldelichigslasvyhkppnafv
Timeline for d1gw5b_:
![]() Domains from other chains: (mouse over for more information) d1gw5a_, d1gw5m1, d1gw5m2, d1gw5s_ |