Lineage for d1gw5b_ (1gw5 B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 284904Superfamily a.118.1: ARM repeat [48371] (13 families) (S)
  5. 285045Family a.118.1.10: Clathrin adaptor core protein [74771] (2 proteins)
  6. 285049Protein Adaptin beta subunit N-terminal fragment [74774] (1 species)
  7. 285050Species Human (Homo sapiens) [TaxId:9606] [74775] (1 PDB entry)
  8. 285051Domain d1gw5b_: 1gw5 B: [70630]
    Other proteins in same PDB: d1gw5a_, d1gw5m1, d1gw5m2, d1gw5s_
    complexed with ihp

Details for d1gw5b_

PDB Entry: 1gw5 (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core

SCOP Domain Sequences for d1gw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw5b_ a.118.1.10 (B:) Adaptin beta subunit N-terminal fragment {Human (Homo sapiens)}
skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl
elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc
eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa
lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer
vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval
rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat
evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn
kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt
lltaivklflkkpsetqelvqqvlsxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxieptlldelichigslasvyhkppnafv

SCOP Domain Coordinates for d1gw5b_:

Click to download the PDB-style file with coordinates for d1gw5b_.
(The format of our PDB-style files is described here.)

Timeline for d1gw5b_: