Lineage for d1gw5a_ (1gw5 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 359730Superfamily a.118.1: ARM repeat [48371] (14 families) (S)
  5. 359853Family a.118.1.10: Clathrin adaptor core protein [74771] (2 proteins)
  6. 359854Protein Adaptin alpha C subunit N-terminal fragment [74772] (1 species)
  7. 359855Species Mouse (Mus musculus) [TaxId:10090] [74773] (1 PDB entry)
  8. 359856Domain d1gw5a_: 1gw5 A: [70629]
    Other proteins in same PDB: d1gw5b_, d1gw5m1, d1gw5m2, d1gw5s_
    complexed with ihp

Details for d1gw5a_

PDB Entry: 1gw5 (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core

SCOP Domain Sequences for d1gw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw5a_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment {Mouse (Mus musculus)}
gmrglavfisdirnckskeaeikrinkelanirskfkgdkaldgyskkkyvckllfifll
ghdidfghmeavnllssnrytekqigylfisvlvnsnselirlinnaikndlasrnptfm
glalhcianvgsremaeafageipkilvagdtmdsvkqsaalcllrlyrtspdlvpmgdw
tsrvvhllndqhlgvvtaatslittlaqknpeefktsvslavsrlsrivtsastdlqdyt
yyfvpapwlsvkllrllqcypppedpavrgrltecletilnkaqeppkskkvqhsnakna
vlfeaisliihhdsepnllvracnqlgqflqhretnlrylalesmctlassefsheavkt
hietvinalkterdvsvrqravdllyamcdrsnaqqivaemlsyletadysireeivlkv
ailaekyavdytwyvdtilnliriagdyvseevwyrviqivinrddvqgyaaktvfealq
apachenlvkvggyilgefgxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SCOP Domain Coordinates for d1gw5a_:

Click to download the PDB-style file with coordinates for d1gw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gw5a_: