Class b: All beta proteins [48724] (149 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (6 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Laccase [49557] (5 species) consists of three domains of this fold |
Species Melanocarpus albomyces [TaxId:204285] [74873] (1 PDB entry) |
Domain d1gw0a3: 1gw0 A:344-559 [70625] |
PDB Entry: 1gw0 (more details), 2.4 Å
SCOP Domain Sequences for d1gw0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw0a3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces} rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad lrqrisqededdfnrvcdewraywptnpypkidsgl
Timeline for d1gw0a3: