Lineage for d1gvib2 (1gvi B:506-588)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328173Protein Maltogenic amylase [51031] (4 species)
  7. 1328221Species Thermus sp. [TaxId:275] [51032] (2 PDB entries)
  8. 1328223Domain d1gvib2: 1gvi B:506-588 [70608]
    Other proteins in same PDB: d1gvia1, d1gvia3, d1gvib1, d1gvib3
    complexed with bcd

Details for d1gvib2

PDB Entry: 1gvi (more details), 3.3 Å

PDB Description: thermus maltogenic amylase in complex with beta-cd
PDB Compounds: (B:) maltogenic amylase

SCOPe Domain Sequences for d1gvib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvib2 b.71.1.1 (B:506-588) Maltogenic amylase {Thermus sp. [TaxId: 275]}
gdvafltaddevnhlvyaktdgnetvmiiinrsneaaeipmpidargkwlvnlltgerfa
aeaetlcvslppygfvlyavesw

SCOPe Domain Coordinates for d1gvib2:

Click to download the PDB-style file with coordinates for d1gvib2.
(The format of our PDB-style files is described here.)

Timeline for d1gvib2: