Lineage for d1gvha3 (1gvh A:254-396)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859894Family c.25.1.5: Flavohemoglobin, C-terminal domain [52370] (1 protein)
    contains additional globin domain
    automatically mapped to Pfam PF00175
  6. 2859895Protein Flavohemoglobin, C-terminal domain [52371] (2 species)
  7. 2859899Species Escherichia coli [TaxId:562] [75158] (1 PDB entry)
  8. 2859900Domain d1gvha3: 1gvh A:254-396 [70603]
    Other proteins in same PDB: d1gvha1, d1gvha2
    complexed with cl, fad, hem, na

Details for d1gvha3

PDB Entry: 1gvh (more details), 2.19 Å

PDB Description: the x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket
PDB Compounds: (A:) flavohemoprotein

SCOPe Domain Sequences for d1gvha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]}
mavaddtpvtlisagvgqtpmlamldtlakaghtaqvnwfhaaengdvhafadevkelgq
slprftahtwyrqpseadrakgqfdseglmdlsklegafsdptmqfylcgpvgfmqftak
qlvdlgvkqenihyecfgphkvl

SCOPe Domain Coordinates for d1gvha3:

Click to download the PDB-style file with coordinates for d1gvha3.
(The format of our PDB-style files is described here.)

Timeline for d1gvha3: