SCOP 1.75: Domain d1gvha1: 1gvh A:1-146

Lineage for d1gvha1 (1gvh A:1-146)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Flavohemoglobin, N-terminal domain [46528] (2 species)

7. Species Escherichia coli [TaxId:562] [74663] (1 PDB entry)

8. Domain d1gvha1: 1gvh A:1-146 [70601]
   Other proteins in same PDB: d1gvha2, d1gvha3
   complexed with cl, fad, hem, na

Details for d1gvha1

PDB Entry: 1gvh, 2.19 Å

PDB Description: the x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket

PDB Compounds: (A:) flavohemoprotein

SCOP Domain Sequences for d1gvha1:

Sequence; same for both SEQRES and ATOM records:

>d1gvha1 a.1.1.2 (A:1-146) Flavohemoglobin, N-terminal domain {Escherichia coli [TaxId: 562]}
mldaqtiatvkatipllvetgpkltahfydrmfthnpelkeifnmsnqrngdqrealfna
iaayasnienlpallpavekiaqkhtsfqikpeqynivgehllatldemfspgqevldaw
gkaygvlanvfinreaeiynenaska

Timeline for d1gvha1:

• d1gvha1 first appeared in SCOP 1.61
  
• d1gvha1 appears in SCOP 1.73
  
• d1gvha1 appears in SCOPe 2.01
  
• d1gvha1 appears in the current release, SCOPe 2.08