Lineage for d1guwa_ (1guw A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) 
Superfamily d.9.2: Chromo domain-like [54160] (2 families) 
Family d.9.2.2: Chromo domain [54165] (2 proteins) Protein Heterochromatin protein 1, HP1 [54166] (3 species) 
Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (3 PDB entries) 
Domain d1guwa_: 1guw A: [70584]
Details for d1guwa_
PDB Entry: 1guw (more details)
PDB Description: structure of the chromodomain from mouse hp1beta in complex with the lysine 9-methyl histone h3 n-terminal peptide, nmr, 25 structures
SCOP Domain Sequences for d1guwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1guwa_ d.9.2.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31)}
hmveevleeeeeeyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaef
lqsqktahetdks
SCOP Domain Coordinates for d1guwa_:
Click to download the PDB-style file with coordinates for d1guwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1guwa_:
- d1guwa_ is new in SCOP 1.61
- d1guwa_ appears in SCOP 1.63
- d1guwa_ appears in the current release, SCOPe 2.08, called d1guwa1
View in 3D