Class a: All alpha proteins [46456] (284 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
Protein Cytochrome c nitrite reductase [48718] (4 species) |
Species Escherichia coli [TaxId:562] [74807] (2 PDB entries) |
Domain d1gu6g_: 1gu6 G: [70578] complexed with ca, gol, hec |
PDB Entry: 1gu6 (more details), 2.5 Å
SCOP Domain Sequences for d1gu6g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gu6g_ a.138.1.3 (G:) Cytochrome c nitrite reductase {Escherichia coli [TaxId: 562]} veaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghafa vtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivnn lgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchveyy fdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqhpeyetwtagihgk nnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsin dlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhapee glrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekqd fiktvipqweeqarkngllsq
Timeline for d1gu6g_: