Lineage for d1gtta1 (1gtt A:1-213)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199265Fold d.177: FAH [56528] (1 superfamily)
  4. 199266Superfamily d.177.1: FAH [56529] (1 family) (S)
  5. 199267Family d.177.1.1: FAH [56530] (2 proteins)
  6. 199268Protein 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase HpcE [64459] (1 species)
  7. 199269Species Escherichia coli [TaxId:562] [64460] (2 PDB entries)
  8. 199278Domain d1gtta1: 1gtt A:1-213 [70529]

Details for d1gtta1

PDB Entry: 1gtt (more details), 1.7 Å

PDB Description: crystal structure of hpce

SCOP Domain Sequences for d1gtta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtta1 d.177.1.1 (A:1-213) 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase HpcE {Escherichia coli}
mkgtifavalnhrsqldawqeafqqspykappktavwfikprntvigcgepipfpqgekv
lsgatvalivgktatkvreedaaeyiagyalandvslpeesfyrpaikakcrdgfcpige
tvalsnvdnltiyteingrpadhwntadlqrnaaqllsalsefatlnpgdaillgtpqar
veiqpgdrvrvlaegfpplenpvvderevttrk

SCOP Domain Coordinates for d1gtta1:

Click to download the PDB-style file with coordinates for d1gtta1.
(The format of our PDB-style files is described here.)

Timeline for d1gtta1: