Lineage for d1gthd3 (1gth D:288-440)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457627Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 2457640Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 2457641Species Pig (Sus scrofa) [TaxId:9823] [51912] (9 PDB entries)
  8. 2457665Domain d1gthd3: 1gth D:288-440 [70500]
    Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha4, d1gtha5, d1gthb1, d1gthb2, d1gthb4, d1gthb5, d1gthc1, d1gthc2, d1gthc4, d1gthc5, d1gthd1, d1gthd2, d1gthd4, d1gthd5
    complexed with fad, fmn, idh, iur, ndp, sf4, ura

Details for d1gthd3

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil
PDB Compounds: (D:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gthd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gthd3 c.3.1.1 (D:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOPe Domain Coordinates for d1gthd3:

Click to download the PDB-style file with coordinates for d1gthd3.
(The format of our PDB-style files is described here.)

Timeline for d1gthd3: