Lineage for d1gtha5 (1gth A:845-1020)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 191936Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 192023Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (6 proteins)
  6. 192030Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
  7. 192031Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries)
  8. 192044Domain d1gtha5: 1gth A:845-1020 [70487]
    Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha3, d1gtha4, d1gthb1, d1gthb2, d1gthb3, d1gthb4, d1gthc1, d1gthc2, d1gthc3, d1gthc4, d1gthd1, d1gthd2, d1gthd3, d1gthd4

Details for d1gtha5

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil

SCOP Domain Sequences for d1gtha5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtha5 d.58.1.5 (A:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla

SCOP Domain Coordinates for d1gtha5:

Click to download the PDB-style file with coordinates for d1gtha5.
(The format of our PDB-style files is described here.)

Timeline for d1gtha5: