Lineage for d1gted3 (1gte D:288-440)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109343Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 2109356Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 2109357Species Pig (Sus scrofa) [TaxId:9823] [51912] (5 PDB entries)
  8. 2109361Domain d1gted3: 1gte D:288-440 [70457]
    Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea4, d1gtea5, d1gteb1, d1gteb2, d1gteb4, d1gteb5, d1gtec1, d1gtec2, d1gtec4, d1gtec5, d1gted1, d1gted2, d1gted4, d1gted5
    complexed with fad, fmn, iur, sf4

Details for d1gted3

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil
PDB Compounds: (D:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gted3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gted3 c.3.1.1 (D:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOPe Domain Coordinates for d1gted3:

Click to download the PDB-style file with coordinates for d1gted3.
(The format of our PDB-style files is described here.)

Timeline for d1gted3: