Lineage for d1gteb1 (1gte B:2-183)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 149177Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 149196Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 149197Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
  7. 149198Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries)
  8. 149200Domain d1gteb1: 1gte B:2-183 [70445]
    Other proteins in same PDB: d1gtea2, d1gtea3, d1gtea4, d1gtea5, d1gteb2, d1gteb3, d1gteb4, d1gteb5, d1gtec2, d1gtec3, d1gtec4, d1gtec5, d1gted2, d1gted3, d1gted4, d1gted5

Details for d1gteb1

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil

SCOP Domain Sequences for d1gteb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gteb1 a.1.2.2 (B:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa)}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOP Domain Coordinates for d1gteb1:

Click to download the PDB-style file with coordinates for d1gteb1.
(The format of our PDB-style files is described here.)

Timeline for d1gteb1: