Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries) |
Domain d1gt8d5: 1gt8 D:845-1020 [70437] Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a3, d1gt8a4, d1gt8b1, d1gt8b2, d1gt8b3, d1gt8b4, d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c4, d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d4 complexed with fad, fmn, ndp, sf4, uaa |
PDB Entry: 1gt8 (more details), 3.3 Å
SCOPe Domain Sequences for d1gt8d5:
Sequence, based on SEQRES records: (download)
>d1gt8d5 d.58.1.5 (D:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
>d1gt8d5 d.58.1.5 (D:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnple rkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgy qaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
Timeline for d1gt8d5:
View in 3D Domains from same chain: (mouse over for more information) d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d4 |