Lineage for d1gr0a2 (1gr0 A:201-311)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins) 
Protein Myo-inositol 1-phosphate synthase [75484] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [75485] (1 PDB entry) 
Domain d1gr0a2: 1gr0 A:201-311 [70380]
Other proteins in same PDB: d1gr0a1
Details for d1gr0a2
PDB Entry: 1gr0 (more details), 1.95 Å
PDB Description: myo-inositol 1-phosphate synthase from mycobacterium tuberculosis in complex with nad and zinc.
SCOP Domain Sequences for d1gr0a2:
Sequence, based on SEQRES records: (download)
>d1gr0a2 d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis}
qvgatithrvlaklfedrgvqldrtmqlnvggnmdflnmlererleskkisktqavtsnl
krefktkdvhigpsdhvgwlddrkwayvrlegrafgdvplnleyklevwds
Sequence, based on observed residues (ATOM records): (download)
>d1gr0a2 d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis}
qvgatithrvlaklfedrgvqldrtmqlnvggnmdflnmledvhigpsdhvgwlddrkwa
yvrlegrafgdvplnleyklevwds
SCOP Domain Coordinates for d1gr0a2:
Click to download the PDB-style file with coordinates for d1gr0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gr0a2:
- d1gr0a2 is new in SCOP 1.61
- d1gr0a2 appears in SCOP 1.63
- d1gr0a2 appears in the current release, SCOPe 2.08
View in 3D
