Lineage for d1gr0a2 (1gr0 A:201-311)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193860Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 193861Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 194013Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
  6. 194042Protein Myo-inositol 1-phosphate synthase [75484] (2 species)
  7. 194052Species Mycobacterium tuberculosis [TaxId:1773] [75485] (1 PDB entry)
  8. 194053Domain d1gr0a2: 1gr0 A:201-311 [70380]
    Other proteins in same PDB: d1gr0a1

Details for d1gr0a2

PDB Entry: 1gr0 (more details), 1.95 Å

PDB Description: myo-inositol 1-phosphate synthase from mycobacterium tuberculosis in complex with nad and zinc.
PDB Compounds: (A:)

SCOP Domain Sequences for d1gr0a2:

Sequence, based on SEQRES records: (download)

>d1gr0a2 d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis}
qvgatithrvlaklfedrgvqldrtmqlnvggnmdflnmlererleskkisktqavtsnl
krefktkdvhigpsdhvgwlddrkwayvrlegrafgdvplnleyklevwds

Sequence, based on observed residues (ATOM records): (download)

>d1gr0a2 d.81.1.3 (A:201-311) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis}
qvgatithrvlaklfedrgvqldrtmqlnvggnmdflnmledvhigpsdhvgwlddrkwa
yvrlegrafgdvplnleyklevwds

SCOP Domain Coordinates for d1gr0a2:

Click to download the PDB-style file with coordinates for d1gr0a2.
(The format of our PDB-style files is described here.)

Timeline for d1gr0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gr0a1