Lineage for d1gqra_ (1gqr A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184304Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 184305Superfamily c.69.1: alpha/beta-Hydrolases [53474] (23 families) (S)
  5. 184306Family c.69.1.1: Acetylcholinesterase-like [53475] (4 proteins)
  6. 184307Protein Acetylcholinesterase [53476] (5 species)
  7. 184315Species Electric ray (Torpedo californica) [53477] (33 PDB entries)
  8. 184329Domain d1gqra_: 1gqr A: [70374]

Details for d1gqra_

PDB Entry: 1gqr (more details), 2.2 Å

PDB Description: acetylcholinesterase (e.c. 3.1.1.7) complexed with rivastigmine

SCOP Domain Sequences for d1gqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqra_ c.69.1.1 (A:) Acetylcholinesterase {Electric ray (Torpedo californica)}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOP Domain Coordinates for d1gqra_:

Click to download the PDB-style file with coordinates for d1gqra_.
(The format of our PDB-style files is described here.)

Timeline for d1gqra_: