Lineage for d1gqpa_ (1gqp A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 554850Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 554851Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) (S)
  5. 555055Family b.18.1.9: APC10-like [69210] (2 proteins)
    Pfam 03256
  6. 555056Protein APC10/DOC1 subunit of the anaphase-promoting complex [69211] (2 species)
  7. 555057Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74892] (1 PDB entry)
  8. 555058Domain d1gqpa_: 1gqp A: [70372]

Details for d1gqpa_

PDB Entry: 1gqp (more details), 2.2 Å

PDB Description: apc10/doc1 subunit of s. cerevisiae

SCOP Domain Sequences for d1gqpa_:

Sequence, based on SEQRES records: (download)

>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae)}
svlvlddrivdaatkdlyvngfqeeiqyqnptpenlqhmfhqgieildsarminvthlal
wkpssfklgnpvdfalddnydtfwqsdggqphqldimfskrmdicvmaiffsmiadesya
pslvkvyaghspsdarfykmlevrnvngwvalrfldnreddqllkcqfirllfpvnheng
kdthlrgirlyvps

Sequence, based on observed residues (ATOM records): (download)

>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae)}
svlvlddrivdaatkdlyvngfqnptpenlqhmfhqgieildsarminvthlalwkpssf
klgnpvdfalddnydtfwqsdggqphqldimfskrmdicvmaiffsmiadesyapslvkv
yaghspsdarfykmlevrnvngwvalrfllkcqfirllfpvnhengkdthlrgirlyvps

SCOP Domain Coordinates for d1gqpa_:

Click to download the PDB-style file with coordinates for d1gqpa_.
(The format of our PDB-style files is described here.)

Timeline for d1gqpa_: