Class b: All beta proteins [48724] (149 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) |
Family b.18.1.9: APC10-like [69210] (2 proteins) Pfam 03256 |
Protein APC10/DOC1 subunit of the anaphase-promoting complex [69211] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74892] (1 PDB entry) |
Domain d1gqpa_: 1gqp A: [70372] |
PDB Entry: 1gqp (more details), 2.2 Å
SCOP Domain Sequences for d1gqpa_:
Sequence, based on SEQRES records: (download)
>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae)} svlvlddrivdaatkdlyvngfqeeiqyqnptpenlqhmfhqgieildsarminvthlal wkpssfklgnpvdfalddnydtfwqsdggqphqldimfskrmdicvmaiffsmiadesya pslvkvyaghspsdarfykmlevrnvngwvalrfldnreddqllkcqfirllfpvnheng kdthlrgirlyvps
>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae)} svlvlddrivdaatkdlyvngfqnptpenlqhmfhqgieildsarminvthlalwkpssf klgnpvdfalddnydtfwqsdggqphqldimfskrmdicvmaiffsmiadesyapslvkv yaghspsdarfykmlevrnvngwvalrfllkcqfirllfpvnhengkdthlrgirlyvps
Timeline for d1gqpa_: